PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_02277A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 292aa    MW: 32225.8 Da    PI: 5.9132
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_02277AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.7e-151461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd++lv  +   G  +W+++++  g+ R++k+c++rw +yl
  Oropetium_20150105_02277A 14 KGPWTAEEDQKLVSFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                               79******************************99************97 PP

2Myb_DNA-binding574.4e-1870111447
                                S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                 ++ E++l +d+++qlG++ W++Ia++m+ gRt++++k++w+++
  Oropetium_20150105_02277A  70 LSEAEEKLVIDLHAQLGNR-WSKIASHMP-GRTDNEIKNHWNTH 111
                                5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-20563IPR009057Homeodomain-like
PROSITE profilePS5129414.101961IPR017930Myb domain
SuperFamilySSF466892.36E-2711108IPR009057Homeodomain-like
SMARTSM007173.8E-121363IPR001005SANT/Myb domain
PfamPF002493.1E-141461IPR001005SANT/Myb domain
CDDcd001671.54E-91661No hitNo description
PROSITE profilePS5129427.31362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-2564117IPR009057Homeodomain-like
SMARTSM007174.2E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1570111IPR001005SANT/Myb domain
CDDcd001671.45E-1371112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLVSFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEAEEKLVID LHAQLGNRWS KIASHMPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPLTHQPFQ QQTSPAAEAQ RAPPIPPEHQ RPRPEAPATA TNDEPAPPPP LVLSKSPGFC  180
TDEVPMMHPD EIMVAAPTPT TSYSAASAAS SCDNNEEALF PMIMRDEWPA DIIGLDDDMT  240
MIAAAAPSPW DECLLAAQPP SPVFLDPGFS AYQRSGAAFE QDEAWNKLEL F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0362291e-152BT036229.1 Zea mays full-length cDNA clone ZM_BFb0101M11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572214.11e-117PREDICTED: protein ODORANT1
TrEMBLI1I7771e-117I1I777_BRADI; Uncharacterized protein
STRINGBRADI3G36370.11e-117(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.14e-91myb domain protein 43